PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12646.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 214aa    MW: 24512.7 Da    PI: 6.3048
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12646.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31.1e-37131121100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              aCa+Ck++r+kC ++C lapyfp ++ ++f+n+hklFG+sn++k+++ +++++r++a++s++ e++a+ +dPv+G++gvi++l  q
  mrna12646.1-v1.0-hybrid  13 ACASCKHQRKKCDSNCELAPYFPGSKYNEFQNAHKLFGVSNIVKIMSWIEPHQRQAAADSILIEGNAWKNDPVHGCYGVIKDLAAQ 98 
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              ++  +++l++++++
  mrna12646.1-v1.0-hybrid  99 VAFQEKQLSVVNQH 112
                              *********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.63212113IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-3513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDTESSPSPV NHACASCKHQ RKKCDSNCEL APYFPGSKYN EFQNAHKLFG VSNIVKIMSW  60
IEPHQRQAAA DSILIEGNAW KNDPVHGCYG VIKDLAAQVA FQEKQLSVVN QHLAFHKQQQ  120
KIKLEQDQSD YFSDLPDLPD ELMGDVKVFE RGHNYRPNLV GAADEERSFD MELRDEDENP  180
ILPLRRLNNA WSLWTMKKLQ KTRLLAWNIE TVF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460121.11e-135PREDICTED: LOB domain-containing protein 9-like
TrEMBLM5VSQ08e-50M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.16e-35LOB domain-containing protein 22